PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA10383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 597aa    MW: 64973.5 Da    PI: 6.843
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA10383genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.91.1e-14122160241
                        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ +
  Tp57577_TGAC_v2_mRNA10383 122 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVD 160
                                89**************************.********986 PP

2TCR51.71.7e-16206245140
                        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                k++kgC+Ckks ClkkYCeCf+a++ Cse+C+C dCkN e
  Tp57577_TGAC_v2_mRNA10383 206 KHNKGCHCKKSGCLKKYCECFQANVLCSENCRCMDCKNFE 245
                                589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-17121161IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.69122246IPR005172CRC domain
PfamPF036383.0E-11123158IPR005172CRC domain
SMARTSM011141.6E-19206247IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12209244IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MEEGEGGESG SKNVVPPEXX XXXXXXXXXX XXXXXXTAWS DAPAKKIVRQ LDFNTMTEQS  60
KPPQQLLQQM TVMTQKPVAG SPLPPPQPMI GLQHSSVRVG KPESPKPKSR PNFDMKEGTP  120
KKQKQCNCKH SKCLKLYCEC FASGIYCDGC NCVNCFNNVD NEAARREAVE ATLERNPNAF  180
RPKIASSPQG ARDSREETGE GLVLIKHNKG CHCKKSGCLK KYCECFQANV LCSENCRCMD  240
CKNFEGSEER QALFHGDQNN NTYIQQAANA AITGAIGSYG YSSPPVSKKR KGQELFLWPT  300
SKDPSISKSG QQVNHVKGPA AASSSLSPVP NARVANATLG QSPQKLKYRS LLADIVQPHH  360
LKELCSVLVL VSGQAAKTLA DQKSSAEKRT EDQAETSLAS STQEQLPSQK DVDVEKAMDD  420
DCSSANQTDK ISPSNSCSDG ADVPKGRPMS PGTLALMCDE QDTMFMRASS PIGPMNHACN  480
TSSQFPSVQG VTEVYGEQER IVLTQFRDFL NRVITMGEIN ETKCSSLARS ELENQKHPIN  540
KETGNSSTDI VHQQEATSNG EPKTEVPPMA TTSKPVVPGD AVAENGETKQ EMEKEL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1348231e-148AC134823.43 Medicago truncatula chromosome 6 clone mth2-20d18, complete sequence.
GenBankAC2254831e-148AC225483.5 Medicago truncatula clone mth2-25o13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003620600.20.0tesmin/TSO1-like CXC domain protein
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0C3VZM00.0A0A0C3VZM0_MEDTR; Tesmin/TSO1-like CXC domain protein
STRINGGLYMA09G32420.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-163Tesmin/TSO1-like CXC domain-containing protein